Protein Info for GFF6058 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 1, maltose/g3p/polyamine/iron)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 267 (187 residues), 51.2 bits, see alignment E=6.5e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 94% identity to vpe:Varpa_1365)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF6058 ABC transporter, permease protein 1 (cluster 1, maltose/g3p/polyamine/iron) (Variovorax sp. SCN45)
MTQATTSNAWNPRWRLLACVAPAVAFFAAFWLLPVVRLLTLPADKGWATYFAVLTDSRYL
ASMANTVVLSIAVTLATLVLGAAVGIYLARHAFVGKRVLLSLLTLPLSFPGVIIGFFVIL
LGGRQGVVADLSDSLFGQRITFAYGLLGLFLAYLYFSLPRAIATYTAAAESMNTQLEEAA
RSLGASRLRVARDVWMPELAPTTLACGAILFATSMGAFGTAFTLASKFEVIPITIYNEFT
NYANFALAASLSISLGLVTWLVLFVARRFGANPVAR