Protein Info for GFF605 in Xanthobacter sp. DMC5

Annotation: Acetoacetyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00106: adh_short" amino acids 3 to 190 (188 residues), 189.2 bits, see alignment E=1.2e-59 TIGR01829: acetoacetyl-CoA reductase" amino acids 3 to 239 (237 residues), 360.7 bits, see alignment E=2e-112 PF08659: KR" amino acids 5 to 180 (176 residues), 70.2 bits, see alignment E=4.4e-23 PF13460: NAD_binding_10" amino acids 9 to 151 (143 residues), 27.4 bits, see alignment E=5.8e-10 PF13561: adh_short_C2" amino acids 12 to 235 (224 residues), 197 bits, see alignment E=7.5e-62

Best Hits

Swiss-Prot: 70% identical to PHAB_ZOORA: Acetoacetyl-CoA reductase (phaB) from Zoogloea ramigera

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 90% identity to xau:Xaut_3107)

MetaCyc: 72% identical to (R)-3-hydroxybutyryl-CoA dehydrogenase (Cereibacter sphaeroides)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF605 Acetoacetyl-CoA reductase (Xanthobacter sp. DMC5)
MGRVALVTGGTRGIGEAISVALKAAGKTVVANFAGNEEAAKAFTEKTGIPAYKWDVSDFE
ACKAGIAKVEAEVGPIEILVNNAGITRDGQLHKMSLEQWNAVINTNLNSAFNMTRNVIEG
MRDRKFGRIVCISSINGQKGQFGQTNYSAAKAGEIGFVKALAQESARLGITVNAIAPGYI
ATEMVKAVPADALAKIVATIPVGRLGEPEDIARAVVFLTSDDAGFVTGSTMTVNGAQYIC