Protein Info for GFF6037 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, Crp/Fnr family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00027: cNMP_binding" amino acids 34 to 119 (86 residues), 84.8 bits, see alignment E=8.2e-28 PF13545: HTH_Crp_2" amino acids 153 to 216 (64 residues), 52.8 bits, see alignment E=7.8e-18 PF13412: HTH_24" amino acids 176 to 207 (32 residues), 21.9 bits, see alignment 2.6e-08 PF00325: Crp" amino acids 177 to 204 (28 residues), 43.2 bits, see alignment (E = 6.2e-15)

Best Hits

Swiss-Prot: 31% identical to CRPL_MYCTU: CRP-like cAMP-activated global transcriptional regulator (crp) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_1284)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF6037 Transcriptional regulator, Crp/Fnr family (Variovorax sp. SCN45)
MSMLSNLELLRRVPLFASLTATQSASIADAIIKKRFKRAEVVVEQGKKSDALYIILTGRA
RVTSADSRGREVILATLHPGDYLGEMSLIDDEPHSATVRTEIQCDVLMLGRDAFARCLPE
NSSMAYNIMRGLVQRLRHADRKIESLALMDVYGRVARSLLEFAIEDGAGNLKVRDKISRQ
DLAKMVGASREMVSRVMKDLEERGFVQTQDDGSMIVKERLLSLA