Protein Info for PS417_03060 in Pseudomonas simiae WCS417

Annotation: pilus assembly protein TadE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF07811: TadE" amino acids 11 to 53 (43 residues), 39.4 bits, see alignment E=2.6e-14

Best Hits

KEGG orthology group: None (inferred from 78% identity to pfs:PFLU0638)

Predicted SEED Role

"Flp pilus assembly protein TadG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1S7I6 at UniProt or InterPro

Protein Sequence (147 amino acids)

>PS417_03060 pilus assembly protein TadE (Pseudomonas simiae WCS417)
MKTGLPRKQKGAAAIEFALVFGIFFAVFYGLISYSLPLLLMQSFNQAAAEGVRQALSVDP
VAAGTAYSTQVKDRAKTTVINQLNWIPSSFQFSSSFISTTYDGTTLTVEITYPTTNLYSV
FPALVVPGIGPVPNLPANLTARSSLKF