Protein Info for GFF6018 in Variovorax sp. SCN45

Annotation: Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 20 to 275 (256 residues), 44.6 bits, see alignment E=1.7e-15 PF00561: Abhydrolase_1" amino acids 21 to 274 (254 residues), 57.7 bits, see alignment E=2.1e-19 PF12697: Abhydrolase_6" amino acids 36 to 276 (241 residues), 46.3 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_1404)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF6018 Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase (Variovorax sp. SCN45)
MKVTANGLQIEVDDTGGEGRPVILLIMGLGMQLVAWPNGFVRQLVDAGFRVVRHDNRDIG
LSQGFDHAGTGNVVWQTIRHRLGLKVRSAYTLQDMALDSLGVLDALGIARAHIVGASMGG
MIAQRIAAFAPQRSTSLVSIMSSSGARGLPGPRREVTAMLMRRPLGKSEAELVAHSIRLL
RLIQSPAYPQTDEELAERLTFSMRRSYHPAGLMRQMLAIGADDERPQVLPRIQCPTLVLH
GNADALVPMACGEDTARRIPGSTFIPIPGMGHDLPPEVCAILAQHIAAFAHAAEAGDSKP