Protein Info for GFF6017 in Variovorax sp. SCN45

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR03138: queuine synthase" amino acids 10 to 288 (279 residues), 381.7 bits, see alignment E=1.2e-118 PF14819: QueF_N" amino acids 21 to 123 (103 residues), 149.4 bits, see alignment E=4.7e-48 PF14489: QueF" amino acids 201 to 273 (73 residues), 66.6 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 73% identical to QUEF_DELAS: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 95% identity to vpe:Varpa_1405)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF6017 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (Variovorax sp. SCN45)
MSNDHNPNTPEQSQLGRASAYADHYDPSLLFPIARATQREAMGIQSGALPFFGADLWTAF
EVSWLNARGKPQLAIAHFTIPCETPNIIESKSFKLYLNSFNNSQFASIDVVREHLRTDLA
EAAWRGSDQSGGIGVKLLTPELFDREPVHEIDGLDLDRLDIECTRYQPAPELLSADTTQV
HVNETLTSRLLKSNCLVTGQPDWGSVQIRYSGPPIDQAGLLAYIVSFRNHNEFHEPCAER
MFTDIWSRCKPTKLAVYARYTRRGGLDINPFRTSWPQALPANIRTARQ