Protein Info for GFF600 in Sphingobium sp. HT1-2

Annotation: Ribonuclease P protein component (EC 3.1.26.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF00825: Ribonuclease_P" amino acids 3 to 103 (101 residues), 66.1 bits, see alignment E=1.4e-22 TIGR00188: ribonuclease P protein component" amino acids 12 to 103 (92 residues), 47.8 bits, see alignment E=7.6e-17

Best Hits

Swiss-Prot: 61% identical to RNPA_ERYLH: Ribonuclease P protein component (rnpA) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 81% identity to sjp:SJA_C1-07610)

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF600 Ribonuclease P protein component (EC 3.1.26.5) (Sphingobium sp. HT1-2)
MGKRADFLAANRGRRAPMPGFVLLVRERGDGDPAMRIGITVTKKIGGAVIRNRMKRRFRV
LARELLPVHGVAGADHVLIGRAEGVERDFALLRGELEKALGKILTRSEGQGRPPRRKGDS
RPAPPAAKTGQPA