Protein Info for GFF60 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02563: Poly_export" amino acids 28 to 101 (74 residues), 71.7 bits, see alignment E=4.7e-24 TIGR03028: polysaccharide export protein EpsE" amino acids 30 to 269 (240 residues), 366.1 bits, see alignment E=3.3e-114 PF10531: SLBB" amino acids 110 to 155 (46 residues), 29.6 bits, see alignment 4.8e-11 amino acids 194 to 246 (53 residues), 48.8 bits, see alignment E=5.1e-17

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 68% identity to nmu:Nmul_A0242)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF60 Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSTRALLRAGLLAVAAFFGAAAQAQTGPVDYPLAAGDTVRVQVFQNPDLALETRITESGT
ISFPLIGMVRLGGLSVSAAEKKIADALQSGGFLQNPQVTLLLTQIRGSQVSVLGQVGRPG
RFPLETAGTRLSDMLANAGGTTPGGDDVVIVTGQRDGQAFRKTIDLPSLFLRENRADDIV
LSSGDVIYVHRAPVFYVYGEAQRPGSFRIERGMTVMQALAQAGGPTARGSRSRLELHRPQ
DDGSVQTLSPEMNDLVRSNDVLYVRESLF