Protein Info for GFF5988 in Variovorax sp. SCN45

Annotation: Sensory histidine kinase BaeS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 28 to 57 (30 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details PF00672: HAMP" amino acids 216 to 267 (52 residues), 55.5 bits, see alignment 8.8e-19 PF00512: HisKA" amino acids 272 to 334 (63 residues), 48.5 bits, see alignment E=1.1e-16 PF02518: HATPase_c" amino acids 383 to 492 (110 residues), 85.9 bits, see alignment E=4.1e-28

Best Hits

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 60% identity to pba:PSEBR_a3652)

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>GFF5988 Sensory histidine kinase BaeS (Variovorax sp. SCN45)
MWSECGGPRGTLGHGAGVYREGRIWLILWAFMKISITTKLFLAVLATAVLAVVAMGAASR
WNFERGFVGYLNEQGVERLDAVLPNAVAAYRQNGSWDFLRDNPRPWFEIMRPAPSTSGEH
FEPGRSPALVSDLTGAVLRISLLDVDRRVIIGFRDVRKGAVERAVVVDGKTVGWVVMMPF
QSVSEAGDQRFQNNQLRASWIIGSLCVLLAAGIAWWIARVLLAPVKRVAAATHRLAAGDY
ASRVAVASHDEVGQLARDFNSLANTLQRNEQMRREFMADVSHELRTPLGVLHGELEAMED
GVRRLDAQAVRALQHEVGMLNQLVTDLYDLSMADVGALAYRKADVDVRDLLEPSVDAFGE
RLASAGLRLELALPVQPLVVFADEHRMQQLFSNLVLNTCRYTDAGGVLRIEAREEGGEVA
IDLMDSAPGIDAALLPRLFERFFRGESSRNRASGGAGLGLAICRSIVEAHGGTIEAKASP
LGGLWIAIRLPKA