Protein Info for GFF5970 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 118 to 134 (17 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details PF07690: MFS_1" amino acids 66 to 369 (304 residues), 75.9 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 90% identity to vap:Vapar_1341)

Predicted SEED Role

"cyanate transport system protein CynX, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF5970 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MSAAAITRDATVQRTQPAQPGATEDLLIDTEADNRPAPLPTPTPNLGRRILLGASVVLIA
FNLRPVFASLSVVLPEIIKATGLSATAASLLTTLPIVCLGVFAPLAPGLGRRFGTERTLL
GCMVLILLGTMLRGTGNIPLLFLASAIAGSGIAVSNVLLSGLVKRDFAKQAALMMGLYTM
AVCGGAASAAGLTVPIEHALGGGWTMALAMWALPAAVVTLVWAPQALPVRPVASESGFTV
RGLWRDRLAWQVTFFMGLQSALAYIVMGWLAPILRERGLGSETAGYVVSLSVMTQVVTCL
VVPALAVKLRNQRGLAVALAMLTVAAMLAMLFAPLGGVWLWAVLLGIAQGGTFALALTMI
VLRSPDSHVAAHLSGMAQGVGYMVAAFGPLVAGLLHGWTGSFRASSWLFIGLGIALVIAG
LGAGRTKHVGAVTVPRGA