Protein Info for GFF596 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Two-component sensor PilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 127 to 155 (29 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF00512: HisKA" amino acids 340 to 402 (63 residues), 52.9 bits, see alignment E=3.1e-18 PF02518: HATPase_c" amino acids 450 to 558 (109 residues), 66.5 bits, see alignment E=2.7e-22

Best Hits

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>GFF596 Two-component sensor PilS (Hydrogenophaga sp. GW460-11-11-14-LB1)
MARDVSSQFAPSWYSAYEGSHAQSREQRMRAFVRLWRAFMRARVFIATVLLALQVFMLVS
QTGGPNWLVVVCSAHLCIALLTLYLWRPAEQAAPMHIQWLLTIGVDVLVFALLQSFQVGS
INYTALFALPVLLASILGSLTLALAASASVTLYLLGEAALHAPLFSELSTARFLQAALTG
TGFFLVAVLANQLAIRLAREEALTASSQAAARAQAQVNELVIESLTVGVLVVDPHGVVRS
ANPAAQAMLLGQVSPQAAKLLLSARSSWQHLAHLVNETFARGEALETETTIDNEDRPSQR
LHARTRLTAQSGRGAGLCVLFLEDLREVEARVRTEKLASMGRMSAAVAHEIRNPLSAITQ
ANALLDEEVQAPAQKRLTRMIEQNAQRLSRIVDDILNVARAQPNQDTTSAPSLPLDQTVR
QIAHEWVRQSKAERILGVHAHAPAAFVGFDPEHLRRLLINLLDNALRHASGKPSSIRLIT
QPSGSDHIRLSVWSDGQALEASVMRHLFEPFFSSESRSSGLGLYICRELCERYGAQIAYR
RTRLDQREGNEFYALIPAAGPAPAHEPTQQSLAYPAVDSIATRAEPHGHPLSGDTPLATR