Protein Info for GFF5933 in Variovorax sp. SCN45

Annotation: Pentapeptide repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00805: Pentapeptide" amino acids 18 to 51 (34 residues), 23.5 bits, see alignment 6.4e-09 amino acids 39 to 76 (38 residues), 27.4 bits, see alignment 3.9e-10 amino acids 145 to 175 (31 residues), 16.3 bits, see alignment (E = 1.2e-06) amino acids 154 to 186 (33 residues), 15.8 bits, see alignment 1.7e-06 amino acids 194 to 228 (35 residues), 28.1 bits, see alignment 2.5e-10 amino acids 234 to 273 (40 residues), 28.4 bits, see alignment 1.9e-10 amino acids 264 to 303 (40 residues), 34.8 bits, see alignment 1.9e-12 amino acids 289 to 320 (32 residues), 32.6 bits, see alignment (E = 9.6e-12) PF13599: Pentapeptide_4" amino acids 39 to 116 (78 residues), 37.6 bits, see alignment E=4.4e-13 amino acids 111 to 186 (76 residues), 30.9 bits, see alignment E=5.6e-11 amino acids 170 to 246 (77 residues), 40.6 bits, see alignment E=5.4e-14 amino acids 232 to 305 (74 residues), 36.7 bits, see alignment E=8.9e-13

Best Hits

KEGG orthology group: None (inferred from 32% identity to scl:sce5664)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>GFF5933 Pentapeptide repeat family protein (Variovorax sp. SCN45)
MDRNEVLRRVQLAEPVLEADLSGMDFTGEDLSATVFDGCRFDDARLAGADLCESVFIRCS
FARTSMERSRMTGASFAECTVQRAVMADVDMKSVAFFQCTVEGLAMNASRLASVSFVKSK
LDGLLFRQGRLSQVTMVDCETGVLDFAKASLDSCVLMGCDLKRAAFSGTEFSTVVFLKSD
LSGHSFAGQRFATCQFMEADLRGCDFSRAQLAKGNFQKARLAGASFEGAEAANAIFMDAD
LAGARFDRANLVQAIFIGARAADSSFASANLHQSNWTGAALPGARLDGCELTYADFSHAD
LRRADLRGASMFRSNLHEAKDEGALYTDRARALESDPVLLASERWQPAPLS