Protein Info for GFF5921 in Variovorax sp. SCN45

Annotation: T6SS protein serine/threonine phosphatase PppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF13672: PP2C_2" amino acids 16 to 204 (189 residues), 32.8 bits, see alignment E=8.1e-12 PF07228: SpoIIE" amino acids 27 to 233 (207 residues), 29.6 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to vap:Vapar_0545)

Predicted SEED Role

"putative phosphoprotein phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF5921 T6SS protein serine/threonine phosphatase PppA (Variovorax sp. SCN45)
LEIEIVTLSRQGGRNYNEDVHGHWHDERHVACLVADGAGGHGGGDVAAATARGSMLAGFA
AAPGLDEPTLRALVTQANLDVVARQAEGGKLAGMRSTIVFAAIDLEDHALAWAHSGDSRA
YLFRGGAIVARTTDHSLVQQMVAGGMLDEEGARLHPQRNMLLSALGSIEEAPDIAVSDRM
RLLPGDVLLLCSDGVWEPLGDERLIDTLHASRTPSQWTELIDAQVKAHAKPGYDNYTALT
LWVIEEDADATRLMEPVAMPAPADDAS