Protein Info for GFF590 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 7 to 214 (208 residues), 143.6 bits, see alignment E=3.3e-46 PF01914: MarC" amino acids 8 to 217 (210 residues), 154.8 bits, see alignment E=1e-49

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 69% identity to xau:Xaut_4291)

Predicted SEED Role

"probable multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF590 hypothetical protein (Xanthobacter sp. DMC5)
MHLTNAVNIFITVFAALFPIVNPLGTAPIFLTFVRRCSPQVRERIARSVAIYGFLLLFGS
LAIGAQILLFFGISLPVLRVAGGLVVAVVGWNILHEDENAPDKAQGVELDEARAQDEAFY
PLTLPLTVGPGSIAATVALAAGHTPTWKTDPLFQLSSVAGALAGLLAVSLTVYFSFREAP
TLERVLGKTGTNVLVRLFAFILFAIGVQIIWLGVEALIIQLPR