Protein Info for GFF589 in Sphingobium sp. HT1-2

Annotation: Gll3385 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF08003: Methyltransf_9" amino acids 45 to 177 (133 residues), 27.2 bits, see alignment E=7.7e-10 PF13489: Methyltransf_23" amino acids 58 to 184 (127 residues), 31.1 bits, see alignment E=7.6e-11 PF01209: Ubie_methyltran" amino acids 63 to 183 (121 residues), 32.7 bits, see alignment E=2e-11 PF01135: PCMT" amino acids 68 to 156 (89 residues), 33.8 bits, see alignment E=1.2e-11 PF13847: Methyltransf_31" amino acids 71 to 180 (110 residues), 47.7 bits, see alignment E=5.2e-16 PF13649: Methyltransf_25" amino acids 76 to 172 (97 residues), 47.1 bits, see alignment E=1.3e-15 PF08242: Methyltransf_12" amino acids 78 to 174 (97 residues), 36.8 bits, see alignment E=2.3e-12 PF08241: Methyltransf_11" amino acids 78 to 176 (99 residues), 45.7 bits, see alignment E=3.4e-15

Best Hits

KEGG orthology group: None (inferred from 86% identity to sjp:SJA_C1-07790)

Predicted SEED Role

"Gll3385 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF589 Gll3385 protein (Sphingobium sp. HT1-2)
MIRMVLAGPLLLLAACGPLAGGNQSERAAGAASFPRADRPVAPIVSTRWSSEEARDRVNE
AEDIMDRAGIRPGMTIADIGAGEGYYTVRLAKRVGARGRVLAEDILPEVIDALSRRITRE
NWTNVSVKLGAPEDPKLPENSFDRIFMVHMYHEIAEPYAFLWHLSPALKADGELIVVDAD
RPTDQHGTPRRLLTCELAAMGFRLEEMIAKPTAGGYMARFRRSTARPDPSSIVPCALRG