Protein Info for GFF588 in Variovorax sp. SCN45

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 17 to 45 (29 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details PF07291: MauE" amino acids 14 to 95 (82 residues), 32.1 bits, see alignment E=2e-11 PF07681: DoxX" amino acids 16 to 96 (81 residues), 80.2 bits, see alignment E=2.1e-26 PF02077: SURF4" amino acids 57 to 139 (83 residues), 53.6 bits, see alignment E=4e-18

Best Hits

Swiss-Prot: 43% identical to YPHA_SHIFL: Inner membrane protein YphA (yphA) from Shigella flexneri

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_3122)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>GFF588 putative membrane protein (Variovorax sp. SCN45)
MATANTTPNPAQDTLALIGRILVAYLFIPAGFGKLMGFGGTVGYITSAGLPLPEVAAAIA
IIIELGLGIALLLGFKTRWTAIVMAIFTVVTALFFHKYWSAPDAMKMMQQINFNKNMAIA
GGLLALAAFGAGRFSIDKK