Protein Info for GFF588 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribosomal protein L11 methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 17 to 301 (285 residues), 210.5 bits, see alignment E=1.8e-66 PF06325: PrmA" amino acids 17 to 308 (292 residues), 257.9 bits, see alignment E=4.6e-80 PF13489: Methyltransf_23" amino acids 176 to 239 (64 residues), 29.9 bits, see alignment E=1.4e-10 PF05175: MTS" amino acids 179 to 246 (68 residues), 34.1 bits, see alignment E=6.1e-12 PF13649: Methyltransf_25" amino acids 182 to 245 (64 residues), 30.9 bits, see alignment E=1.1e-10 PF08241: Methyltransf_11" amino acids 183 to 249 (67 residues), 27 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 74% identical to PRMA_POLSJ: Ribosomal protein L11 methyltransferase (prmA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 77% identity to aaa:Acav_0791)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF588 Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSAEAFQLTQPPAGSLFELVLLVPEAAVDDVGDALVALDALSVSVEDADAMTDAESALFG
EPGMPPPKEGWQRSRVVALFPTDAAAREAARLLAAQDFFAGCVVQGVRAVPDQDWVRLTQ
SQFEPVEITPSFWIVPTWHEPPTAAQQVIRLDPGLAFGTGTHPTTRMCLRWTAQHGPVGP
RVLDYGCGSGILAIGAAKFGAREIVAVDIDPAAVESTRLNAEANHAVLSAGLPDLASGEH
DLVLANILATPLKVLAPLLCSHVRAGGHLVLAGILARQADELIEAYAPWVTLRVSDEEDG
WILMTAVKA