Protein Info for GFF5871 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 191 to 213 (23 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 44 to 177 (134 residues), 73.1 bits, see alignment E=4.5e-24 PF07695: 7TMR-DISM_7TM" amino acids 190 to 389 (200 residues), 60.1 bits, see alignment E=6.2e-20 PF00512: HisKA" amino acids 442 to 502 (61 residues), 50.7 bits, see alignment 3.1e-17 PF02518: HATPase_c" amino acids 552 to 658 (107 residues), 75.9 bits, see alignment E=6.6e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (763 amino acids)

>GFF5871 hypothetical protein (Variovorax sp. SCN45)
VVAIRGIAAALLLCAASWLAGPADAATLRLGEAPELPLVLDEVVELLEDPDGLLSREDAE
ASTRFRPGTHAQMRQGFTNSAFWLRLAVVNDTGTVQPLRLVLNTTWLQHVDFHVQRRIGA
PTGKAAWTLERAGVSVPLRGDRDRVPTLSLDLRPGEQARLLVRVQSHSSLKFAPELHTAD
SWREAESSHALLDGLLIGGMLVLAVYSLTLWLISRKPLMASQSLGFMLVALYEATYRGHA
RLVLWPDSTDWSYRAAGVVAGCSVLSLLLYLHVLSRRGPVRPPGLPVIAVLATSQVVAVL
GTLLGPYAPFARLGNLTVLLLVFSLTASSFIYMRRAGPGGKLAFPVMTIIMVGVCLRLTE
LSLPTHMLPGFDAYALGFPGMLMGLVALSSWTHHLSRQQHLAQRTLVLWQAEEQQRLRDE
VARKTHTLNAALEQAEHQAREQTRLMAYVTHDLRAPLATIIGHVRLLRDEMPQPPDRLQA
IERSAAYQLSLIDDLLDYAKGELLPFSFEPRPARLQALLDDIAQYADTLAQRRNNAFELE
VQGALPRAVLIDSKRFHQLLLNLLSNAAKFTHGGKIGLRVRARPRAESWRLQFEVWDSGA
GIDLKEQARIRQAFAENAPSASGNGLGLVIARRIVQRMGGRLLLMSHPNLGTRVRFSVIV
KDAPEEPRSVAPQAPSSPPLQSPRLRLRRPPTPVPAIAPLPAAARAELEVLARDGRWTDL
HEWTDRLAAADSRHAALVDAVRQALDRLDFEHIRLLARATPKL