Protein Info for GFF5865 in Variovorax sp. SCN45

Annotation: Probable iron export permease protein FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 8 to 257 (250 residues), 174.7 bits, see alignment E=1.2e-55 PF03649: UPF0014" amino acids 10 to 250 (241 residues), 250.1 bits, see alignment E=1e-78

Best Hits

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 62% identity to axy:AXYL_03076)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF5865 Probable iron export permease protein FetB (Variovorax sp. SCN45)
MNATIHLDATDLMLATLLVLLNAGASLALHLRLHRQVLWAAARMVVQLLLVGLVLRFVFS
AASPAVTLTIVVLMILAAAREVAVRPSYRLARGGNFRIGAAAVGISSVATVVLALMTAIR
PQPWYDPRYAIPLMGIVLGSVLNSASLGLDSFFEGVTTGRARIEAQLSLGATIHEALSEL
TRASIRRGMIPIINQMSAAGVITLPGIMTGQLLAGMDPVEAAKYQILLLFLLTGAGGLAA
AGSVYLAARSMTDDRQRLRSDRLS