Protein Info for GFF586 in Sphingobium sp. HT1-2

Annotation: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 243 to 308 (66 residues), 68.9 bits, see alignment E=3.2e-23 PF21082: MS_channel_3rd" amino acids 316 to 399 (84 residues), 42.3 bits, see alignment E=8.4e-15

Best Hits

KEGG orthology group: None (inferred from 67% identity to sjp:SJA_C1-06880)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF586 Potassium efflux system KefA protein / Small-conductance mechanosensitive channel (Sphingobium sp. HT1-2)
MTQLSAWLARLPGNADITQPLIAVGIALLLHAMAYGLARLLAPRIRERLPALSELASTHV
RPMLRHAISAPLFATALALWPADSIAHLILGAALALAVALFALHLLQALSFPRWAITPLA
LLLFVMVISGSSGGIAPVGSMLDDVALTLGKRRISLLDLLSVAATLVALLAGIRLANRLI
RRSIQKAPDLDPTQKLLGQKLAGIAVIIAAFFIGIDILGIDLTAFTVFSGALGLAVGFGL
QKTVGNLIAGIILLMDRSIKPGDVIAVGDSFGWVSKIGVRAVSIITRDGKKHLIPNENLM
TQEVENWSYSDRNIRVRIPVGISNDSDIALAQQLMLEAAEESPRALKHPEPKVWLTALGQ
YRLEHEIRVWINDPENGVGGVTSDVLMRVLDKFKAQGIIVPYPRQIIELRQPQDRHDPAM
NEPDISDHSPS