Protein Info for GFF585 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF12849: PBP_like_2" amino acids 260 to 467 (208 residues), 115.9 bits, see alignment E=2.9e-37 PF13531: SBP_bac_11" amino acids 262 to 478 (217 residues), 26.5 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to stm:STM3528)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>GFF585 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAFIGVPLLVNIITIIVGGMWAYISVLENSIPVARSIEEATIIPVALLGAGLIFLCGRIW
GKGNASEVNPEWRDCCLLMPALVVLMGWVILMFLTDLNIRAIGCKPIAQVVQTLWLVPRV
ISFFNGWVWAVLLIPVGSQLCFALGYGGARWGVLRGGAGYTCRNLLVICLLFFGSCAVYQ
SHLYAVKYPAPESSEYLYFRDYQAHTWGNKLTGLRDEPTLLLTQNWPRLDGATAGLPLYA
SAFYALTRFPDDICPEDYLENQGTIEAYQNILNGNADLIFVAQPSTAQKQLAEASGVKLV
YTPFAREAFVFIVNQNNPVSSLSDVQIRGIFSGRITHWNEVGGEAIDIKPWQRPENSGSQ
TAMLAKVMKETKLMPAQTTSVATAMGDMVDIVAEYRNTHNAIGYTFRYYATQMHSNKEIK
LLAINDVAPTVENIRNGSYPYTVDVYMVTREHPTAETQKLVDWFLSPQGQQLVQDVGYVP
LYPAAK