Protein Info for GFF584 in Variovorax sp. SCN45

Annotation: Tripartite tricarboxylate transporter TctA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 21 to 51 (31 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 357 to 383 (27 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 419 to 445 (27 residues), see Phobius details amino acids 469 to 492 (24 residues), see Phobius details PF01970: TctA" amino acids 22 to 441 (420 residues), 472.9 bits, see alignment E=4.1e-146

Best Hits

KEGG orthology group: None (inferred from 97% identity to vpe:Varpa_3541)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>GFF584 Tripartite tricarboxylate transporter TctA family (Variovorax sp. SCN45)
MIGQSLQDLWFGFGVAFQGSNLLWSFFGVLVGNLIGVLPGMGALQAISILLPLTYVMHPV
PAILMLAGIFYGSQYGGAIGAILMNMPSHPPHAVTCLDGYPMTKQGKGGVALGVTMIASF
FAASVGIIVMIFASPLLVQIAFKFGPTEIFSIMLLGLLAGSTMSRGSPLKGVAMTLFGLL
CGVVGTDVNSGSFRFAFGLPELSDGLELVAISMGLFGVADFLLNVNRMKAIGDTGTLKLS
DMRPSKEELKRAFPAMIRGTLVGTVFGAMPGTGPTITTFIAYALERKVSKTPNKFGTGMI
EGVAGPEASAHSKTQVDFIPTMSLGIPGDAVMALILGALLIQGIQPGPQLITEHPDIFWG
LIASFWIGNVILVILNVPMIGVWVKLLKVPYKYLFPAAMFFIATGVYSTQNSLFQIWEVL
VFGIVGAVLMTLEFSVAPILLGFVLGPMVEENFRRALLLSRGDMSVFVTRPISGTFIGLC
ALLLLGVGYSAWRGRGGRKAMVDLPKPPEGAPPAEAASMGGGGK