Protein Info for GFF5828 in Variovorax sp. SCN45

Annotation: Branched-chain amino acid ABC transporter, permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 280 (272 residues), 105.3 bits, see alignment E=1.6e-34

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 69% identity to bpd:BURPS668_0056)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF5828 Branched-chain amino acid ABC transporter, permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MEDYLPFVISGLGLGAVYALSGVGLVVLYRSSGVLNFAFGAIGAIGAYVAWSMLEADWPQ
ALAWSAAIVTSMLLSLAYGRLLAPRLSHRDPTIRSIATLGFALVVVGFTEWYWGEQPRRL
VLPTDAGAIDFVLGEVEVRLTHTRALGLTLAVLMMGGVGLLLSKTRVGLKMRALANDRDL
SALLGIRVLGVDTVAWVLSGAFAGVCGLLLANIVRLQATLLTFLVIPAFAAAIIGRLHSL
PATVAGGIAIGVLEALAITVPGFASFRTATPFLIALAMIVFYRTGTRQA