Protein Info for GFF5815 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 320 (294 residues), 111.8 bits, see alignment E=1.7e-36 amino acids 227 to 390 (164 residues), 36.4 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_4638)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF5815 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
VSSTSKAPKSPAGLTPLLTLVFAVACGLCVANIYYAQPLIGPIADTLQLRPGLAGLIMTL
TQLGYGAGLLLLVPLADVVENRRLIVGALFGAVIGLVGIALSDSAVTFLAASFVVGACAV
AAQVLLPFASHLAPEATRGKVVGNIMAGLLGGIMLARPFASMVASALGWRAVFWLSAVLM
AVLIVVLWRVLPQRRPHASVGYARTMASLPGIVWNTPVLRRRGLYQGMMFSGFQAFWTAV
PLALAHEFGMGQGGIAAFALAGAAGALMAPIAGRLADRGLTRPATGIAIAVALFSFVLGA
VAMHYHSLAGLVAAGILLDGAVQLCQVLNFRSLFMLAPELRGRLNGLFMTFIFICAAVAS
GIAAAVYAFHGWGGLCLLGGGYVLVALLYYATEFKRGAVPAPAA