Protein Info for GFF5814 in Variovorax sp. SCN45

Annotation: Rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 32 to 34 (3 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details PF09335: VTT_dom" amino acids 29 to 155 (127 residues), 42.7 bits, see alignment E=7.8e-15 PF00581: Rhodanese" amino acids 207 to 304 (98 residues), 29.5 bits, see alignment E=8.4e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_4639)

Predicted SEED Role

"Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF5814 Rhodanese-related sulfurtransferase (Variovorax sp. SCN45)
MAQLMSLLVQNAILVVFAASFAARLGLPVPAAAVLVLTGALLAAGDVSVPGVVLAAVLAN
LLGDGAWFYAGRRFGYRFMRLLCRISLSPDTCVRRGESLITDWGGLSLVAAKFVPGVSVV
APPMAGALGMSVRRFIGFDVGAALVWTGLFLGLGWVFRNQIQDVLAIMAQAGGIATAALA
VLLVVILAVRYWRRRAFMRLTGMPRISVDELHELLSGEEPPLVIDVRGKAGMQVDPRRIP
GAMPYTLKALQQRNIDLSHAFGRDVVLYCNCPNEVSAAQAARVLLARGARRALPLTGGLD
AWVASGRPTSTD