Protein Info for GFF5810 in Variovorax sp. SCN45

Annotation: Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 60 to 387 (328 residues), 265.7 bits, see alignment E=2.4e-83 PF16576: HlyD_D23" amino acids 83 to 308 (226 residues), 43.5 bits, see alignment E=3.5e-15 PF13533: Biotin_lipoyl_2" amino acids 85 to 130 (46 residues), 40.7 bits, see alignment 2.5e-14 PF13437: HlyD_3" amino acids 196 to 302 (107 residues), 23.6 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 45% identical to MDTA_PROMH: Multidrug resistance protein MdtA (mdtA) from Proteus mirabilis (strain HI4320)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 80% identity to vpe:Varpa_4643)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF5810 Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA (Variovorax sp. SCN45)
MTTTTTTTATTGHPLFQRRSTWLAAATLVVLLGGGAWALTQQSAHAAKPEAAQAPPPVQV
TTVRVKQQEVQTYRSGIGTVASMATVTVKARIDGQLDKVGFVEGQDVKAGQMLAQLDPRT
LQAQLAQAQATRAKDQATLVNARADLKRYTTLIAQDAATQQQLDTQKALVNQLEATVQND
AAQVQYAEVQLSFTRISSPMDGRVGARLVDPGNIVHAADTNGLVVINQIDPIAVQFTLPE
DAVQDINRLQQKSSQPLSVVAYDRSGAQMLGTGKLILLNNQIDTTSGTVQLKGSFANPQH
ALWPGQYVNVRLQLERRPDSLTVPAAAVQRGQDNTYVWVVDDENKVSNVPVHVVQIADGT
AVIDKGLSVNQRVVVDGQYKLKPGSTVIEPPPAQKAGAGTDAKKPASGSSN