Protein Info for GFF581 in Xanthobacter sp. DMC5

Annotation: Thiamine-monophosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 8 to 331 (324 residues), 285.4 bits, E=2.4e-89
• PF00586: AIRS
  • amino acids 30 to 142 (113 residues), 95.5 bits, E=2.7e-31
• PF02769: AIRS_C
  • amino acids 154 to 314 (161 residues), 40.3 bits, E=3.6e-14

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 79% identity to xau:Xaut_4282)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (331 amino acids)

>GFF581 Thiamine-monophosphate kinase (Xanthobacter sp. DMC5)
MEGGGSGEDRFIARYFRPIAGSQGALGLLDDAALLSPPEGCDLVLTKDAVVAGVHFFPDD
PPAAIASKALRVNLSDLAAKGAAPIGALMAIALPKGTSDAWMEAFAAGLGADAEAFSCPI
LGGDTVSTPGPVTITITALGAVPKGEFVPRTGAQAGMAIFVSGTIGDAALGLRLRQNGNA
PAFAGLSGEQRAHLLDRYLNPQPRLALARVLRRHAASAMDVSDGLAGDLAKMLAASGCGG
KLEARRVPLSAAAAAAVKADPSLLAVALSGGDDYEILACVPRAAIPAFTLDAAQAGVPVA
LIGETRAGSGLDVTDAGGHLLDLGSGSYSHF