Protein Info for GFF5794 in Variovorax sp. SCN45

Annotation: Polyphosphate kinase 2 (EC 2.7.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR03707: polyphosphate kinase 2" amino acids 53 to 278 (226 residues), 378.8 bits, see alignment E=5.1e-118 PF03976: PPK2" amino acids 54 to 278 (225 residues), 361.6 bits, see alignment E=8.6e-113

Best Hits

Swiss-Prot: 81% identical to PK21B_PSEAE: Polyphosphate:ADP phosphotransferase (PA2428) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_4019)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF5794 Polyphosphate kinase 2 (EC 2.7.4.1) (Variovorax sp. SCN45)
MLTSALPDHEELMQRIARDLIDSYDEELELEIEDRNIDGLDPTAGTSAATDKAARQAYFK
ELFRLQGELVKLQDWVQHSKQKVVILFEGRDAAGKGGVIKRITQRLNPRVARVAALPAPN
DRERTQWYFQRYAAHLPAAGEMVLFDRSWYNRAGVERVMGFCTDDEYEEFFRTVPEFEKM
LVRSGIKLIKYWFSITDDEQHMRFLGRIHDPLKQWKLSPMDLESRRRWEEYTKAKEIMLE
RTHIAEAPWWVVQAVDKKKARLNCISHLLGQMPYKEVPHPPVELPERERHADYLRQPVPA
SMIVPEIY