Protein Info for GFF5790 in Variovorax sp. SCN45

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF00892: EamA" amino acids 38 to 170 (133 residues), 29 bits, see alignment E=6e-11 amino acids 179 to 303 (125 residues), 31.9 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_4660)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF5790 putative membrane protein (Variovorax sp. SCN45)
VSQSPGPGIDNAATVALADSRSAVRRTARSIESERILAGIGLVVLATACFATLDTATKFS
TLGVPILMGVWFRYAFQAVATTAVLLPLHGTALLRTQHPRYQALRGALLLSSSVFSFLSL
RYMPLAEFTSIVLIAPLVITLLAATTLKEHVSPLRWTLVAGGFAGTLVILRPGGGTFSWA
ILLPLGLVLTNAWFQVLTSKLAQTENPLTMHFYTGWIGTLIASLVVPFAWTALPSWEWWA
LLCLMGFMGTVGHFMLILAYQRAPASTLTPYLYAQIAFAMLGGWLIFSHVPDRFSLIGMA
MIAVCGAAGAWLTVRERRVPIEPAES