Protein Info for GFF579 in Xanthobacter sp. DMC5

Annotation: 6,7-dimethyl-8-ribityllumazine synthase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 19 to 158 (140 residues), 148.6 bits, E=5.5e-48
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 20 to 155 (136 residues), 109.4 bits, E=7.6e-36

Best Hits

Swiss-Prot: 84% identical to RISB_XANP2: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 84% identity to xau:Xaut_4280)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Protein Sequence (163 amino acids)

>GFF579 6,7-dimethyl-8-ribityllumazine synthase 1 (Xanthobacter sp. DMC5)
MVTTRRETAVEADSALEGARVVIVEGRYYEALADELLAGARAVLEAAGVAFEVITVPGAL
EIPVAAEIAIAASEEGGEPVDAVVGLGVVIRGETFHFDIVAGESARGIMELGMAHALPVG
NGILTVDTEAQAWERARVSEGNKGGGAAEAALSLLRLKRRLEA