Protein Info for GFF5784 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details PF04020: Phage_holin_4_2" amino acids 8 to 110 (103 residues), 112.1 bits, see alignment E=9.5e-37

Best Hits

KEGG orthology group: K08972, putative membrane protein (inferred from 90% identity to vpe:Varpa_4667)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF5784 hypothetical protein (Variovorax sp. SCN45)
MLNNLAPFLIHWAITAISLWVASHLFRGIKFESTGALVVSALLLGLANAVVKPLLIVLTL
PLTLVTLGLFLLVINALMILLVAALVKGFRVSGFWTALFASIFISILSVVIGSFVTSDDP
AEKVQMPQTGNWL