Protein Info for GFF5773 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ADA regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF02805: Ada_Zn_binding" amino acids 14 to 78 (65 residues), 101.9 bits, see alignment E=3.8e-33 PF12833: HTH_18" amino acids 121 to 199 (79 residues), 86.6 bits, see alignment E=3e-28 PF06029: AlkA_N" amino acids 212 to 328 (117 residues), 99.3 bits, see alignment E=4.4e-32 PF00730: HhH-GPD" amino acids 334 to 486 (153 residues), 43.4 bits, see alignment E=9.5e-15

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 70% identity to pna:Pnap_1101)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>GFF5773 ADA regulatory protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAAMNRSDRIDEDACYRALCSHDARFDGQFFTAVTSTGIYCRPVCRVRTPRRENCRFFTH
AAQAEQAGFRPCLRCRPELAPRERHWSTEDASTILLQQATLWLDDPQHWPDDNGGAMGER
LAARLGVSDRHLRRVFEDRLGVSPLQYLLTRKLLTAKQLLADTDLPVTQIALASGFASVR
RFNAAFLAHYRLNPTQLRRETAPRGTGQGTMVRLGYRPPYDVAATLGFFRQRLIDGVAFV
DEERLQLGQTLRMELGGRTHQGWMVAGFDEARCQLELRVSDDLREVLPQVIHRLRAALDL
DADPTAINAVLHGAFPAGDGLRVPGALDGFELAVRAVLGQQITVAAARTLAQRLVNRFGE
AIETPHAGLSRLFPTPAALARAEGDGLGELGIVRQRQAAIVALARGVAEQGLVLNGSADV
PATLTALKAMPGIGDWTAQYIAMRALRWPDAFPAGDVALHKVMGVRESKHPAREAEAASL
AWKPWRSYAVVRAWSAGHVVSSTGASE