Protein Info for GFF5762 in Variovorax sp. SCN45

Annotation: Flagellar motor rotation protein MotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details PF13677: MotB_plug" amino acids 14 to 65 (52 residues), 68.1 bits, see alignment 3.8e-23 PF00691: OmpA" amino acids 156 to 247 (92 residues), 36.6 bits, see alignment E=5.2e-13

Best Hits

Swiss-Prot: 54% identical to MOTB_SALTY: Motility protein B (motB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 73% identity to vap:Vapar_4157)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF5762 Flagellar motor rotation protein MotB (Variovorax sp. SCN45)
MSEGKPQIIIKHVHKGGGGGHHGGGWKIAYADFMTAMMAFFLVMWLLSISSPKQREGIAE
HFRMPLRVAMHGGDKASLSNSMIPGGGADVMHVEGEVKQADAEEEADATRLAEMKKKLDE
LIEKSPVFQQFRSQILIDITTEGLRLQIVDTENRPMFELASARVVPHMRAILRELAPALN
GLPNKLTLSGHTDAIVYNNDRSYGNWELSADRANASRRELVVGGLTEGKVLRVIGLADSM
HLDRAEPRNPINRRISIILLNRRTQERIERENSSDGGSMRVGKLTPAGAAPKAAAALPAQ
TPAPVAVTAPVATEAPAATTE