Protein Info for GFF576 in Xanthobacter sp. DMC5

Annotation: Transcriptional repressor NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 147 (147 residues), 167.1 bits, see alignment E=1.4e-53 PF22811: Zn_ribbon_NrdR" amino acids 1 to 42 (42 residues), 68.8 bits, see alignment 2.9e-23 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 82.7 bits, see alignment E=2.2e-27

Best Hits

Swiss-Prot: 78% identical to NRDR_XANP2: Transcriptional repressor NrdR (nrdR) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 78% identity to xau:Xaut_4277)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>GFF576 Transcriptional repressor NrdR (Xanthobacter sp. DMC5)
MRCPYCGGLETQVRDSRPTEDNTAIRRRRICPDCGGRFTTFERVQLRELMVLKRSGRRVP
FEREKLEKSVSVALRKRPVENERVERMINGIVRQLESVGEGDITSETIGEMVMEGLKQID
DVAYVRFASVYRNFREAKDFENALAELSHEGEPRLGEPRLADAEPAVEKPRARPTTPRSG
E