Protein Info for GFF576 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glycogen debranching enzyme (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 TIGR02100: glycogen debranching enzyme GlgX" amino acids 7 to 633 (627 residues), 877.7 bits, see alignment E=2.3e-268 PF02922: CBM_48" amino acids 13 to 97 (85 residues), 70.4 bits, see alignment E=2e-23 PF18390: GlgX_C" amino acids 571 to 655 (85 residues), 142.6 bits, see alignment E=4e-46

Best Hits

Swiss-Prot: 100% identical to GLGX_SALCH: Glycogen debranching enzyme (glgX) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 90% identity to cko:CKO_04850)

MetaCyc: 85% identical to limit dextrin alpha-1,6-glucohydrolase (Escherichia coli K-12 substr. MG1655)
RXN0-5146 [EC: 3.2.1.196]

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 3.2.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>GFF576 Glycogen debranching enzyme (EC 3.2.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGY
LAGARPGLRYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR
DNAAVAPKSVVISDHYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALG
HPVMVAYFKQLGITALELLPVAQFASEPRLQRMGLTNYWGYNPMAMFALHPAWASSPETA
LDEFRDAVKALHRAGIEVILDIVLNHSAELDLDGPTFSLRGIDNRSYYWIRDDGDYHNWT
GCGNTLNLSHPGVVEYACECLRYWVETCHVDGFRFDLASVMGRTPTFRQDAPLFAAIKAC
PVLSTVKLIAEPWDIGEGGYQVGNFPPPFAEWNDHFRDAARRFWLPRNLTTGEFACRFAA
SSDVFKRNGRAPGASVNLLTAHDGFTLRDCVCFNQKHNEANGEENRDGTNSNYSDNHGKE
GLGGPLDLMERRRDSIHALLATLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNALTWLDW
QQANRGLTTFTAALIRLRQQIPALTGNSWWEEGDGNVRWLNKNAQPLSADEWQNGPKLMQ
ILLSDRFLIAINATLEVTDIVLPEGEWRAVPPFAGEDNPVITAVWQGPAHGLCVFQRG