Protein Info for GFF5756 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 130 (125 residues), 60.3 bits, see alignment E=1.3e-20 amino acids 141 to 280 (140 residues), 55.2 bits, see alignment E=4.9e-19

Best Hits

KEGG orthology group: None (inferred from 61% identity to rfr:Rfer_1080)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF5756 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
VPISHLLLALSVVFVWGTNFVVIRWGLDGLPPFLFATLRFAFSALPWLLFIPRPTAPWRK
IAAFGVLLGVGQFGLLFLAMRSSISPGLASLVVQLQVFFTIGLSLWLMGERVRGFQVVGL
LLALAGLGVIAAHLDASVTLLGMGLVLSAAFFWSLANLVVKSLGPVNMLHFMVWSSVFAV
PPLFALSWLIEGPQAITGSLQQAGTLVWASVLWQAVGNTLFGYGVWNWLLARHPAATVTP
LALLIPVFGMGASALSLGESLPGWKLGAAALVLLGLAVIVLWPRWRPGR