Protein Info for GFF575 in Xanthobacter sp. DMC5

Annotation: Serine hydroxymethyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF00464: SHMT" amino acids 23 to 400 (378 residues), 585.9 bits, see alignment E=5e-180 PF00155: Aminotran_1_2" amino acids 106 to 347 (242 residues), 35.6 bits, see alignment E=9.5e-13 PF01041: DegT_DnrJ_EryC1" amino acids 156 to 275 (120 residues), 27.5 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 78% identical to GLYA_METPB: Serine hydroxymethyltransferase (glyA) from Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 94% identity to xau:Xaut_4276)

MetaCyc: 74% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF575 Serine hydroxymethyltransferase 2 (Xanthobacter sp. DMC5)
MASQDANRSSVTEEMNRFFTASLAETDPEIAGAVQAELGRQRDEIELIASENIVSRAVLE
AQGSVLTNKYAEGYPGKRYYGGCQFVDVAENLAIERAKKLFGCGFANVQPNSGSQANQGV
FFALLQPGDTFLGLNLAAGGHLTHGSPVNMSGKWFKPVPYTVREDDQRIDYEAVAQLADQ
HKPKLIVAGGSAYPRIIDFAKMRAIADSVGALLMVDMAHFAGLVAGGAHPSPFPHAHVVT
TTTHKTLRGPRGGMILTNDEDIAKKVNSAIFPGIQGGPLMHVIAAKAVAFGEALRPEFKL
YAKNVVENAKALAETLKGHGFAIVSGGTDTHLMLVDLRPKRLTGKVSEAALGRAHITCNK
NGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFQQVGNLIAEVLDVLSQKGSDEDSLVEA
AVREKVSTLLARFPIYP