Protein Info for GFF5740 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 81 (29 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 54 to 250 (197 residues), 302.6 bits, see alignment E=6.3e-95 PF00813: FliP" amino acids 54 to 246 (193 residues), 271.7 bits, see alignment E=2e-85

Best Hits

Swiss-Prot: 73% identical to FLIP_PECCC: Flagellar biosynthetic protein FliP (fliP) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 89% identity to vap:Vapar_4178)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF5740 Flagellar biosynthesis protein FliP (Variovorax sp. SCN45)
MTHPALRRGLRAALLLLAATLPLAAWTQGLPGLTSTPGPAGSQTWSLSVQTLVLLTSLTF
LPALLLSMTSFTRILIVLGLLRTAIGTQTSPPNQILVGLSLFLTFFVMSPVFDKAYTEAY
QPFAENKISADKALERGIAPFKTFMLKQTRETDLALFARLAKAPEMQGPEDVPLRILLPS
FVISELKTAFQIGFTIFIPFLIIDLVVASVLMSMGMMMVPPASIALPFKLMLFVLADGWQ
LMIGALAQSFYI