Protein Info for GFF5732 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 30 to 208 (179 residues), 202.5 bits, see alignment E=5.3e-64 PF01435: Peptidase_M48" amino acids 212 to 417 (206 residues), 119.6 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 75% identity to pol:Bpro_1699)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>GFF5732 macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDNASFAFTAVFCALLLLGLLVRTVLASRQIRHVARHRGAVPAAFSDTIALSAHQKAADY
TIAKGRFGLLETAIDAALLLGWTLLGGLDWLNQRLLDAMGGGLLQQLALLAAVVLIGGLV
TLPLGWYATFRIEERFGFNKMTMSLWLRDLVKGTLLGALIGLPIAALVIWLMGAAGPTWW
LWAWGVWMAFSLIATVLGPTLIAPLFNKFEPLSDETLKARVNALMQRCGFAAKGLLVMDG
SKRSAHANAYFTGFGAAKRVVFFDTLLKQLSPDEIDAVLAHELGHYKRRHILKRIVLMFA
LSLTGFALLGWVSSQAWFFSGLGVTPSMEAPNDALALLLFMMVVPLFTFFLSPLMAQLSR
QHEFEADAYAVAHTSGHDLASALLKLYKDNASTLTPDPLYARFYYSHPPASERLPRLLTA