Protein Info for GFF572 in Variovorax sp. SCN45

Annotation: Transcription termination protein NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR01951: transcription antitermination factor NusB" amino acids 40 to 168 (129 residues), 110 bits, see alignment E=5e-36 PF01029: NusB" amino acids 43 to 165 (123 residues), 104.8 bits, see alignment E=2.4e-34

Best Hits

Swiss-Prot: 88% identical to NUSB_VARPS: Transcription antitermination protein NusB (nusB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 92% identity to vpe:Varpa_3526)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>GFF572 Transcription termination protein NusB (Variovorax sp. SCN45)
MTEDTSKPLKPAKPADGGKPRQSRVGLTSTGARKASAKSNRSRAREFALQALYQHLVGRN
DPTDIDHFTRDLAGFHKADALHYDALLHGSIEGAEQLDALIRPLLDRKFEEISPIEHAVM
WIGVYEFQNCLDVPWRVVLNECIELAKEFGGTDGHKYVNAVLNGLAPQLRPLEVEADRAS
GKAKA