Protein Info for GFF572 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 3 to 157 (155 residues), 156.2 bits, see alignment E=3.2e-50 PF02075: RuvC" amino acids 3 to 152 (150 residues), 149.8 bits, see alignment E=2.8e-48

Best Hits

Swiss-Prot: 69% identical to RUVC_ACIAC: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 69% identity to aaa:Acav_0764)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF572 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRILGIDPGLQCTGFGVIDTEGAALHYVASGTIQTSPKDGALLPERLKILFDGITEVVAR
YQPQVSVCEIVFVNVNPQATLLLGQARGACLTALVANQLEVAEYTALQLKKAVAGSGRAG
KPQMQEMVKRLLRLPGLPGKDAADALGLAITHAQVSRTLAAISKVSTQQARTHAAYKAGR
VY