Protein Info for GFF5715 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Urea carboxylase-related ABC transporter, ATPase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00005: ABC_tran" amino acids 31 to 177 (147 residues), 103.9 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 44% identical to TAUB_BURL3: Taurine import ATP-binding protein TauB (tauB) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 72% identity to pna:Pnap_0039)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, ATPase protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF5715 Urea carboxylase-related ABC transporter, ATPase protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTPHPHTHPVPKIAIRDVFKRFDGAPVNALENINLDIRANEFVTFVGASGCGKSTLLRT
IGGLEVQSSGELLVDGQAVDGPGIDRAMVFQHYSLYPWMTVCQNIKFCRQLAAHTEGRTS
SDVEAADGRADALLRLMGLETMGHAWPNQLSGGMQQRVAIARALMGRPDIVLMDEPFGAL
DAQTREVMHDLIRYVHKLEKATIVFVTHDVEEALYLGDRVVLMAPRPGRIDTIYEVPFGE
QRTQDLKHAPEFVRLKRDILDRIRETSGMKTDLEQLQRMTGHTA