Protein Info for GFF571 in Xanthobacter sp. DMC5

Annotation: Biopolymer transport protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 32 to 240 (209 residues), 313.1 bits, see alignment E=5e-98 PF01618: MotA_ExbB" amino acids 100 to 223 (124 residues), 109.3 bits, see alignment E=5.7e-36

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 61% identity to rpb:RPB_1655)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF571 Biopolymer transport protein ExbB (Xanthobacter sp. DMC5)
VPAPSAPAPVEAVPSVPAPESLADARLPHDLSPWGMFMAADLVVKAVMLGLAFASVLTWS
VWFAKSLELLFARRAVSRTLKALRGAVTLSDAAAEMPKANSPATATVRAALAEWHASAGL
PVDGIKERVAVALSRIEAKAGRRMTAGTGVLATIGATAPFVGLFGTVWGIMNAFIGISKA
QTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARAIAAYKANLADTSAEVMRHLSR
DLDRAAAEVETPRLRAAE