Protein Info for GFF570 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Gluconate utilization system Gnt-I transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00356: LacI" amino acids 2 to 38 (37 residues), 50.9 bits, see alignment 2.1e-17 PF00532: Peripla_BP_1" amino acids 50 to 297 (248 residues), 115.8 bits, see alignment E=5.3e-37 PF13407: Peripla_BP_4" amino acids 52 to 260 (209 residues), 50.9 bits, see alignment E=3.2e-17 PF13377: Peripla_BP_3" amino acids 161 to 316 (156 residues), 87.3 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 97% identical to GNTR_ECOLI: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli (strain K12)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to sec:SC3473)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF570 Gluconate utilization system Gnt-I transcriptional repressor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VGVTKMTVSRFLRNPEQVSVALRGKIAAALDELGYIPNRAPDILSNATSRAIGVLLPSLT
NQVFAEVLRGIEAVTDAHGYQTMLAHYGYKPEMEQERLESMLSWNIDGLILTERTHTPRT
LKMIEVAGIPVVELMDSQSPCLDIAVGFDNFEAARQMTAAIIARGHRHIAYLGARLDERT
IIKQKGYEQAMRDAGLVPYSVMMEQSSSYSSGIELMRQARREYPQLDGIFCTNDDLAVGA
AFECQRLGLKIPDDMAIAGFHGHDIGQVMEPRLASVLTPRERMGSIGAERLLARIRGETV
TPKMLDLGFTLSPGGSI