Protein Info for GFF57 in Variovorax sp. SCN45

Annotation: Putative polysaccharide export protein YccZ precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 49 (49 residues), see Phobius details PF02563: Poly_export" amino acids 104 to 196 (93 residues), 72.4 bits, see alignment E=4.2e-24 PF22461: SLBB_2" amino acids 202 to 280 (79 residues), 61.8 bits, see alignment E=7.9e-21 amino acids 287 to 372 (86 residues), 50.9 bits, see alignment E=2.1e-17 PF10531: SLBB" amino acids 204 to 251 (48 residues), 28.9 bits, see alignment 1.3e-10 amino acids 287 to 337 (51 residues), 15.9 bits, see alignment 1.4e-06

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 66% identity to vap:Vapar_3189)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF57 Putative polysaccharide export protein YccZ precursor (Variovorax sp. SCN45)
MDRIHSAKPSPGMRTLSALALAEYRLRWLGLALLLSLGLAGCAAPGFGTPGPMNYGDGNQ
GGDATASAAAGNGKIIPITPDLIRTQIAQRPQGVPDGIKQLFAAPPVYTIGPGDVVGIIV
YDHPELLPNAGAVIAQQSDPTGVTVAPGFIVDAKGEIFFPYIGRTKVQGLTESGASELVA
RRIKAFVKDPQVSVRIQSFRSQRAYVQGEVRTPGLQIFTDVPMTLSEAISRAGSFTQLGD
RSHITLTRGGVSTELNLPMLQAMGVDGNGIPLRNGDIVNVGTREDNRVYVMGEVRAPSAL
QMRLNGRLSLNEALGDVGGPDLTTADPGQIYVVRNSPDNSGVPQVFNLNAKNPVALALAD
RFELQPRDVVYVDHVPLATWSRVFSLILPSAQVINLARDTARR