Protein Info for GFF5687 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inner membrane protein YbhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 19 to 295 (277 residues), 50.8 bits, see alignment E=8.7e-18

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 52% identity to vpe:Varpa_0011)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF5687 Inner membrane protein YbhQ (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSPARQQAWRWTKRVAPWALAALVLALVAQQARAVDWSQVWVSLRQLPPWRLALAVGLAA
LSCTVYAGFDLVGRHLTRHGLPVPRTLGAAAISYAFNLNFGALVGGLAMRLRLYTRWGVA
AATVAKVIALSMTTNWLGYLWVAGGVLLWSPPVLPAGWAPGDAVLRSLGAAMVGLALAYL
VLCAVSRRRTLRWRDHELALPGGRLALVQALAGGANWVLMGGIVWLLFAGRVDFATVLGA
LLMAAVAGVVTHVPAGLGVLEAVFVATLSGALPTAEVLAVVLAYRAAYYLLPLALALPAY
AWSEAAARRGGGKRRQGVEKASRPALRRSGRPT