Protein Info for GFF5683 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details PF00230: MIP" amino acids 4 to 225 (222 residues), 167 bits, see alignment E=2.9e-53 TIGR00861: MIP family channel proteins" amino acids 11 to 225 (215 residues), 186.9 bits, see alignment E=2.3e-59

Best Hits

Swiss-Prot: 74% identical to AQPZ2_AGRFC: Aquaporin Z 2 (aqpZ2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06188, aquaporin Z (inferred from 81% identity to vap:Vapar_4980)

MetaCyc: 69% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF5683 Aquaporin Z (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTHSNAKKWSAEFLGTFWLTFGGCGSAVLAAAFPELGIGFTGVSLAFGLTVLTGAYAFGP
ISGGHFNPAVSVGLALGGRFRAAELPGYVIAQVLGAVAAAGVLYLIATGKPGFEVGGFAT
NGYGEHSPGRYSLTAALLIEVVLTAVFLLVILGATAKRAAAGFGGLAIGLCLTLIHLISI
PVTNTSVNPARSTGPALFGPSIALDQLWLFWLAPLVGAAIGALIWRALLADSDES