Protein Info for GFF566 in Xanthobacter sp. DMC5

Annotation: S-adenosylmethionine:tRNA ribosyltransferase-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 1 to 356 (356 residues), 356.7 bits, see alignment E=5.6e-111 PF02547: Queuosine_synth" amino acids 4 to 356 (353 residues), 396.6 bits, see alignment E=4.3e-123

Best Hits

Swiss-Prot: 82% identical to QUEA_XANP2: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 82% identity to xau:Xaut_4270)

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>GFF566 S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Xanthobacter sp. DMC5)
MRVDAFDFHLPEDRIALRPAEPRDTARMLVVRPGATPELEDRIVGDLPDFLRSGDAVVVN
DTRVIPAALEGVRSREGGSDVAVEATLIKRLAPDRWRAFAKPGKRLRVGDRIRFGGEGSA
CLLGTLDAAVAAKEEDGSIVLAFDFAGDVLDEAVAAVGHMPIPPYIAARRHEDARDKDDY
QTLFARVAGSVAAPTASLHFTPDLLARMAATGATLHKVTLHVGPGTFLPVKAEDTSGHTM
HAEWGEVTHETADALNAAKAKGGRIFTIGSTSTRLIESAAGEDGLIRPFVGETDIFITPG
YRFRAVDGMLTNFHLPRSTLVMLVAAFIGHEPQKRAYAHAIAENYRFYSYGDACLLLPQG
GA