Protein Info for GFF5657 in Variovorax sp. SCN45

Annotation: Formate dehydrogenase O beta subunit (EC 1.2.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 258 to 279 (22 residues), see Phobius details TIGR01582: formate dehydrogenase, beta subunit" amino acids 8 to 288 (281 residues), 439.6 bits, see alignment E=2.1e-136 PF12838: Fer4_7" amino acids 39 to 116 (78 residues), 38.4 bits, see alignment E=5.7e-13 PF13247: Fer4_11" amino acids 94 to 190 (97 residues), 83.4 bits, see alignment E=4.6e-27 PF13237: Fer4_10" amino acids 96 to 146 (51 residues), 25.7 bits, see alignment 3.5e-09 PF00037: Fer4" amino acids 130 to 149 (20 residues), 23.5 bits, see alignment (E = 1.5e-08) PF09163: Form-deh_trans" amino acids 248 to 290 (43 residues), 75.6 bits, see alignment 8.4e-25

Best Hits

Swiss-Prot: 64% identical to FDNH_ECOLI: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Escherichia coli (strain K12)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 73% identity to put:PT7_2351)

MetaCyc: 64% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF5657 Formate dehydrogenase O beta subunit (EC 1.2.1.2) (Variovorax sp. SCN45)
MSSLQTLDIAARSATTTPSPEIRHRPQVQQVAKLIDVSTCIGCKACQVACMQWNDLRDEV
GTNHGTYDNPVDLTPSSWTVMKFSEVEPEAGKLEWLIRKDGCMHCDDPGCLKSCPSPGAI
VKYANGIVDFISEHCVGCGNCVTGCPFDVPRISKADNKAYKCSLCSDRVGVGLEPACVKA
CPTGALHFGTKEDMHDYAAERIVDLKDRGFANAGVYDPAGVGGTHVMYVLQHADRPGLYA
DLPKDPHISPLVSLWKGVAKPLAMVAMIGAVVGSFFHYMKVGPIEPKEDHPDADRDGHPD
DVAVIEEPPRTPPPPTAPRA