Protein Info for GFF5655 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 261 to 277 (17 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF00892: EamA" amino acids 18 to 152 (135 residues), 58.2 bits, see alignment E=5.8e-20 amino acids 164 to 299 (136 residues), 44.6 bits, see alignment E=8.9e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF5655 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPPPAHPLPSPTPRQGLALAVALGLMLLWGSNYSVQKAVMAEIGPAALVFMRYLVTPACA
IALLLWRYGWRWPRLERGDWVGLMGLAALGHVAHVNVMTQAIHLSTAFSSALISALGPMF
TLLLVRVLHGQRFTRLQVGGVALAMAGVLVFLSDKFALMRTQGLGDLLLLFAALLFSAHT
VAASRLFSRHGVTLVMAYTTLLAMAPMLLINAPQALQVPWAELPAALWWGLLWSLAVASF
AGWLAWGWLNDHLGVSRTAPLLYLLPPVAGVISWMALGESFSGLKIAGAVMAGVGVAVTQ
FSCNPADAPRHQTP